Easy Chicken and Rice Casserole - Quick Weeknight
30-MINUTE MEALS! Get the email series now
Royal Recipe

Easy Chicken and Rice Casserole

5 from 1 vote
1 Comments
Olivia Grace
By: Olivia GraceUpdated: Mar 7, 2026
This post may contain affiliate links. Please read our disclosure policy.

A comforting, weeknight-friendly casserole with tender chicken, fluffy rice, and gooey cheddar — ready in under an hour and perfect for busy families.

Easy Chicken and Rice Casserole

This casserole has been my Go-To weeknight lifesaver for years. I first put this combination together on a rainy evening when I had a half rotisserie chicken, a couple of soup cans in the pantry, and a hungry family waiting at the table. The result was creamy, savory, and exactly the kind of dish that changes dinner schedules forever — simple ingredients, minimal hands-on time, and a satisfying, homey finish. The rice cooks up tender right inside the casserole while the condensed soup and chicken broth form a silky sauce that clings to every forkful. When the cheddar melts on top, it becomes the kind of comfort food that disappears from plates within minutes.

What I love most is how forgiving the formula is. Swap vegetables, use leftover turkey, or turn it into a gluten-free version with a different soup base — the structure of the dish still shines. I discovered this on one of those nights where timing mattered more than technique, and the fact that the rice cooks from dry inside the dish makes this a real time-saver. It’s the kind of recipe you can confidently bring to a potluck or make on a Sunday to reheat all week; it reliably comforts and feeds a crowd without complicated steps.

Why You'll Love This Recipe

  • Fast and reliable: ready in about 55 minutes total with just 10 minutes of active prep — perfect for busy weeknights when you want hearty food without fuss.
  • Pantry-friendly: uses canned condensed soup and uncooked minute rice so you can pull it together even when shopping is sparse.
  • Crowd-pleasing: creamy texture, tender chicken, and melted cheddar make it attractive to kids and adults alike.
  • Make-ahead and freeze-friendly: assemble ahead and refrigerate before baking, or bake, cool, and freeze individual portions for later.
  • Flexible: swap in different veggies, use leftover roasted poultry, or swap cheeses for varied flavors without losing the comforting base.
  • Minimal equipment: a single 9×13-inch dish and basic mixing tools are all you need — less cleanup, more dinner time.

I remember the first time I brought this to a neighborhood potluck: people asked for the recipe before the casserole was half gone. My in-laws started making it for their busy weeknights, and my kids now request it whenever school is rough. It’s one of those recipes that earns trust — consistently good, forgiving with substitutions, and quick enough to become a staple.

Ingredients

  • Condensed cream of chicken soup: 3 (10.5-ounce) cans — provides a rich, savory base and thickens the liquid so the rice becomes creamy. Look for a brand you trust; low-sodium varieties are a good choice if you watch salt.
  • Chicken broth: 1 cup — use low-sodium broth to control salt, or substitute with broth made from the rotisserie carcass for extra depth.
  • Minute rice: 2 cups uncooked — quick-cooking rice absorbs the sauce as it bakes; measure by the cup and level it for consistent texture.
  • Cooked chicken: 2 cups shredded or chopped — rotisserie chicken is perfect for convenience, but leftover roasted or poached breasts work equally well.
  • Frozen mixed vegetables: 2 cups — use a medley with carrots, peas, and corn, or swap broccoli and cauliflower for a different profile.
  • Seasonings: 1 teaspoon garlic powder, 1 teaspoon onion powder, 1/2 teaspoon Italian seasoning, and pepper to taste — these aromatics bring balanced savory notes without fresh chopping.
  • Scallions: 1/2 cup chopped — adds a fresh, oniony brightness; green parts can be used for a milder flavor.
  • Cheddar cheese: 3 cups grated, divided — 1 cup mixed into the casserole and 2 cups for topping creates a melty, golden finish. Sharp cheddar gives a punchier flavor; mild cheddar keeps it kid-friendly.

Instructions

Preheat and prep: Preheat the oven to 375°F and position the rack in the middle. Grease a 9×13-inch casserole dish with cooking spray or a thin smear of butter to prevent sticking. This even heat and mid-oven placement allow the rice to cook through without the top burning. Combine soup and broth: In a mixing bowl, whisk together the 3 cans of condensed cream of chicken soup and 1 cup chicken broth until smooth. This thinned mixture will soak into the rice and cook it gently. If you are using low-sodium soup, taste later and adjust seasoning after baking. Layer ingredients in the dish: Into the prepared casserole dish add the 2 cups uncooked minute rice, 2 cups cooked chicken, 2 cups frozen mixed vegetables, garlic powder, onion powder, Italian seasoning, freshly ground pepper, 1/2 cup chopped scallions, and 1 cup of the grated cheddar. Distribute ingredients evenly so rice cooks uniformly. Pour and toss: Pour the soup and broth mixture over the layered ingredients. Use a spatula or fork to toss everything gently until the rice and other ingredients are coated. Smooth the top into an even layer — this helps the rice absorb liquid and bake uniformly in the allotted time. Cover and bake: Tightly cover the dish with aluminum foil or a fitted lid; sealing is important so steam builds and cooks the rice. Bake for 45 minutes at 375°F. The rice should be tender and most of the liquid absorbed when you remove it from the oven. Finish with cheese: Carefully remove the foil, sprinkle the remaining 2 cups of grated cheddar over the top, and return the dish to the oven uncovered. Bake another 10 to 15 minutes until the cheese is melted and bubbling and edges are lightly golden. Let rest 5 minutes before serving to set. Casserole in baking dish, golden top

You Must Know

  • The dish freezes well: bake, cool completely, then portion into airtight containers and freeze up to 3 months; thaw overnight in the refrigerator before reheating.
  • Storage: refrigerate leftovers in a sealed container for up to 4 days; reheat gently in a 350°F oven or microwave to preserve creaminess.
  • Protein-rich: with chicken and cheese this serves as a filling complete meal, high in protein per serving.
  • Rice handling: using uncooked minute rice is key — do not pre-cook the rice unless you reduce the liquid accordingly, or texture will be different.
  • Allergen notes: contains dairy and may contain gluten depending on the soup brand; see substitutions below for alternatives.

My favorite aspect is how many different lives this casserole has had in my kitchen. On slow Sundays I make it with homemade shredded chicken and fresh herbs; on hectic weekdays, the rotisserie shortcut gets dinner on the table with zero guilt. Watching the top go from pale to golden and then hearing the first scoop delivered to the table is a small ritual I never get tired of — comforting, practical, and reliably good.

Storage Tips

Cool leftovers to room temperature for no more than two hours, then transfer to airtight containers and refrigerate for up to 4 days. For longer storage, divide into individual portions in freezer-safe containers and freeze for up to 3 months. To reheat frozen portions, thaw overnight in the fridge and warm in a 350°F oven until heated through, about 20–30 minutes, or microwave in 1–2 minute bursts. When reheating from frozen, cover loosely with foil to prevent the top from over-browning while the center warms. Use glass or BPA-free plastic containers and label with the freezing date for best practices.

Ingredient Substitutions

If you need to adapt the dish, there are several easy swaps. For a gluten-free version, use a certified gluten-free condensed chicken soup or make a quick roux with gluten-free flour and chicken broth. To make it lighter, substitute half-and-half for the soup and add a bit more seasoning, or use reduced-fat cheddar. Swap the frozen mixed vegetables for fresh seasonal vegetables — blanched broccoli and peas work well. For a dairy-free alternative, use dairy-free cheese and a cream-style dairy-free soup or a blended white bean purée to mimic the creamy sauce. Protein can be swapped to turkey, leftover ham, or a can of drained, shredded chicken in a pinch.

Serving Suggestions

This casserole pairs beautifully with crisp, bright sides to balance the creaminess. Serve with a simple green salad dressed with lemon vinaigrette, steamed green beans with a squeeze of lemon, or roasted Brussels sprouts for texture contrast. Garnish with extra chopped scallions or a sprinkling of smoked paprika for color. For casual family meals, offer hot sauce or chili flakes at the table. For a more formal presentation, spoon onto warmed plates and add a side of roasted heirloom carrots or a crisp fennel and apple salad.

Portion of casserole on plate with garnish

Cultural Background

Combining poultry, rice, and a creamy binder is a long-standing tradition in American home cooking — a direct descendant of one-dish gratins and pot-cooked meals designed for convenience and family feeding. This style of casserole grew in popularity in the mid-20th century when canned soups and quick-cooking rices became household staples, offering a standardized, time-saving approach to comforting food. Regional variations abound: southern versions often include cream-style corn, while Midwestern adaptations may add ham or tater tots. The concept reflects a culinary philosophy of stretching protein and pantry staples into a satisfying communal meal.

Seasonal Adaptations

In spring and summer, replace frozen vegetables with fresh peas, asparagus tips, and sweet corn; reduce baking time slightly if using freshly cooked, softer ingredients. For autumn and winter, swap mixed vegetables for roasted root vegetables and add a pinch of nutmeg or smoked paprika for warmth. Holiday adaptations can incorporate leftover turkey and sage alongside sauteed mushrooms for a richer profile. Small changes to herbs, vegetables, and cheese can make this dish feel seasonal without altering the core method.

Meal Prep Tips

To streamline weeknight cooking, assemble the casserole in a disposable or reusable dish the night before and refrigerate. When ready, remove from the fridge to come closer to room temperature and bake as directed, adding 5–10 minutes to the bake time if chilled through. You can also pre-mix the dry rice with seasonings and cheese in a zip-top bag for quick assembly. For single-serve prep, divide ingredients into oven-safe ramekins for individualized portions — great for lunches or packed dinners.

Make this casserole your own: experiment with cheeses, swap veggies based on what’s in the fridge, and embrace the easy, comforting nature of this classic dish. There’s real joy in feeding people simply and well.

Pro Tips

  • Cover tightly during the first bake to create steam that cooks the rice evenly.

  • Use rotisserie chicken to save time and add smoky depth without extra work.

  • Grate the cheddar from a block for better melting and flavor compared to pre-shredded cheese.

  • If the top browns too quickly, loosely tent with foil during the final bake.

  • Let the casserole rest 5 minutes after baking so the sauce sets and is easier to serve.

This nourishing easy chicken and rice casserole recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long do leftovers last?

Yes — leftovers keep well in the refrigerator for up to 4 days. Reheat in a 350°F oven until warmed through or microwave individual portions.

Can I use fresh vegetables instead of frozen?

If you use fresh vegetables instead of frozen, reduce the initial bake time by 5–10 minutes and check tenderness. Do not pre-cook the minute rice unless reducing the liquid.

Tags

Baked Goodsdinnerrecipecasserolechickenriceweeknightfamily-friendly
No ratings yet

Easy Chicken and Rice Casserole

This Easy Chicken and Rice Casserole recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 8 steaks
Easy Chicken and Rice Casserole
Prep:10 minutes
Cook:55 minutes
Rest Time:10 mins
Total:1 hour 5 minutes

Instructions

1

Preheat and prepare dish

Preheat oven to 375°F and grease a 9×13-inch casserole dish. Position the rack in the middle to ensure even heat distribution.

2

Mix soup and broth

In a mixing bowl, whisk together the 3 cans of condensed cream of chicken soup and 1 cup chicken broth until smooth to create the sauce base.

3

Assemble ingredients

Add the 2 cups uncooked minute rice, 2 cups cooked chicken, 2 cups frozen mixed vegetables, spices, scallions, and 1 cup cheese to the casserole dish and distribute evenly.

4

Combine and level

Pour the soup and broth mixture over the ingredients, toss gently so rice and vegetables are coated, and smooth the top into an even layer for uniform baking.

5

Cover and bake

Cover the dish tightly with foil or a lid and bake at 375°F for 45 minutes, allowing the rice to cook through and the liquid to be absorbed.

6

Top with cheese and finish

Remove the foil, sprinkle the remaining 2 cups grated cheddar over the top, and bake uncovered for 10–15 minutes until cheese is melted and golden. Rest 5 minutes before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 620kcal | Carbohydrates: 55g | Protein:
35g | Fat: 30g | Saturated Fat: 9g |
Polyunsaturated Fat: 6g | Monounsaturated Fat:
12g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@epicula on social media!

Easy Chicken and Rice Casserole

Categories:

Easy Chicken and Rice Casserole

Did You Make This?

Leave a comment & rating below or tag @epicula on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Olivia!

Chef and recipe creator specializing in delicious Baked Goods cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.