Easy Pumpkin Rice Krispies Donuts - Fall Treat Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat

5 from 1 vote
1 Comments
Olivia Grace
By: Olivia GraceUpdated: Jun 15, 2026
This post may contain affiliate links. Please read our disclosure policy.

These no-bake pumpkin Rice Krispies donuts turn pantry staples into a festive fall dessert—soft, chewy, and finished with a simple maple-cinnamon glaze. Ready in minutes and perfect for gatherings.

Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat

This little seasonal treat started as a way to use an extra can of pumpkin I had after making pies one November. I wanted something quick, sweet, and shareable that would still carry the warm, toasted aroma of autumn spices. The first time I made these, my kids marched into the kitchen like clockwork when they smelled the butter and marshmallows melting together. The texture is what surprised me most: chewiness from the marshmallows, light crisp from the puffed rice, and a gentle pumpkin flavor that keeps every bite cozy rather than overpowering.

I learned a few tricks on that first batch that made all the difference. Pressing the mixture firmly into the donut molds yields a neat ring that holds together without being dense; greasing your hands and pan carefully prevents sticking; and finishing each ring with a thin maple-cinnamon glaze gives just the right amount of sweetness and autumn spice. These are the kind of treats you can make with minimal equipment and a short attention span, yet they feel celebratory enough for a weekend brunch or a classroom party. They store well for a few days and are excellent for packing in lunchboxes when you want a little fall in every bite.

Why You'll Love This Recipe

  • Makes a no-bake, kid-friendly fall dessert in under 30 minutes using pantry staples like puffed rice cereal, marshmallows, and canned pumpkin.
  • Soft, chewy texture with a gentle pumpkin spice note—no heavy baking required, ideal for busy afternoons or last-minute gatherings.
  • Press-and-set method means no piping or frying; the donut pan shapes the treats perfectly and makes them easy to serve.
  • Maple-cinnamon glaze adds a glossy finish and a delicate spice balance without adding much sugar; glaze sets quickly so you can serve soon after assembly.
  • Customizable: swap milk for non-dairy, use gluten-free puffed rice, or add mix-ins like toasted pecans for crunch.
  • Great for make-ahead: prepare the rings and glaze them just before serving for the freshest texture.

When I bring these to fall potlucks people are always surprised by how bright and fresh they taste despite being made from simple ingredients. My partner declared them the easiest seasonal dessert he'd tolerated, and my father asked for the recipe after the first bite—so you know they're crowd-pleasers. The combination of marshmallow chew and crisp rice is nostalgic but the pumpkin and spice make them feel new.

Ingredients

  • Butter (3 tablespoons): Use unsalted butter to control seasoning. I often reach for a European-style butter like Plugra for a richer flavor, but any good-quality salted or unsalted stick will work. Melt it gently so it doesn't brown.
  • Mini marshmallows (1 bag / 10 ounces): Mini marshmallows melt faster and give an even texture. I usually keep a bag of Kraft marshmallows on hand; if you prefer vegetarian options, look for marshmallows made with plant-based gelling agents.
  • Canned pumpkin purée (1/2 cup): Not pumpkin pie filling—pure pumpkin purée. Libby's is a reliable brand. The purée gives moisture and a subtle pumpkin flavor without extra sugar or spices.
  • Pumpkin pie spice (1 teaspoon): A ready blend is simplest, but you can use 1/4 teaspoon each of cinnamon, ginger, and nutmeg if you prefer to mix your own.
  • Salt (pinch): Balances sweetness—just a small amount stirred into the melted marshmallow blend makes flavors pop.
  • Rice Krispies cereal (6 cups): Measure by cups and stir in gently. For a gluten-free version, use a certified gluten-free puffed rice cereal.
  • Nonstick spray or butter: For greasing the donut pan and your hands. If you skip the pan and shape by hand, keep a small bowl of butter to grease your palms.
  • For the maple-cinnamon glaze: Powdered sugar (3/4 cup), milk (2 tablespoons; more to thin), cinnamon (1/2 teaspoon), pinch of salt. You can swap milk for cream or a non-dairy alternative like oat milk for a slightly different mouthfeel.
User provided content image 2

Instructions

Melt the butter and marshmallows: Place a large, heavy-bottomed pot over medium-low heat and add 3 tablespoons butter. Once the butter has melted, add the entire 10-ounce bag of mini marshmallows. Stir constantly with a heatproof spatula to prevent scorching. The marshmallows should become glossy and mostly melted in about 3 to 5 minutes—watch for a smooth, elastic texture rather than browning. Incorporate the pumpkin and spices: Lower the heat, then stir in 1/2 cup canned pumpkin purée, 1 teaspoon pumpkin pie spice, and a pinch of salt. Continue stirring until the mixture is fully combined and smooth; the pumpkin will cool the marshmallow slightly, so keep the pan warm but not boiling. If you want an orange hue, add a few drops of orange food dye and stir until uniform. Add the cereal: Remove the pot from the heat and immediately fold in 6 cups Rice Krispies cereal. Work quickly but gently: use a spatula to incorporate the cereal evenly so each piece is coated. The mixture should be sticky but manageable. If it seems too wet, add a cup more cereal a little at a time until it holds shape. Press into molds: Spray a donut pan with nonstick spray or grease it with butter. Grease your hands lightly as well, then scoop portions of the mixture and press firmly into each cavity, compacting to create defined edges. Firm pressure ensures the rings hold together—aim for an even thickness so they bake (or in this case, set) uniformly. Let the pan sit at room temperature until completely cool and set, about 20 to 30 minutes. Pop out and prepare glaze: Once set, gently turn the donut pan over and remove each ring. For the glaze, whisk together 3/4 cup powdered sugar, 2 tablespoons milk, 1/2 teaspoon cinnamon, and a small pinch of salt in a medium bowl. Add extra milk 1 teaspoon at a time if you need a thinner consistency for dipping. Glaze and finish: Dip the tops of each ring into the maple-cinnamon glaze or spoon it over them. Place the glazed rings on a wire rack and allow the glaze to set at room temperature for at least 15 minutes. The glaze will firm slightly but remain tender—store leftovers in an airtight container for up to 3 days on the counter or up to a week refrigerated. User provided content image 1

You Must Know

  • This keeps well at room temperature for up to 3 days if stored in an airtight container; refrigeration extends life to 5–7 days but can slightly firm the texture.
  • Not automatically gluten-free: use certified gluten-free puffed rice to make these safe for those avoiding gluten.
  • Contains dairy (butter and milk) and gelatin in standard marshmallows; vegetarian and vegan versions require specialized marshmallows and plant-based butter/milk.
  • Freeze unglazed rings for up to 3 months on a baking sheet, then transfer to a freezer-safe bag; glaze after thawing to avoid moisture buildup.

My favorite part of this recipe is how portable and adaptable it is: I once made a double batch for a neighborhood bake sale and the rings were the first to disappear. They are a fantastic way to introduce pumpkin flavor to people who might shy away from pumpkin pie, and they travel well for school parties, picnics, and potlucks.

Storage Tips

Store cooled, glazed rings in a single layer in an airtight container at room temperature for up to three days; stacking with parchment between layers prevents sticking. If you refrigerate, allow the rings to come to room temperature before serving to regain tenderness. For longer storage, freeze unglazed rings on a baking sheet until solid, then transfer to a freezer-safe bag for up to three months. Thaw overnight in the refrigerator or a few hours at room temperature, then glaze just before serving to keep the finish glossy.

Ingredient Substitutions

For a dairy-free version swap butter for coconut oil or a plant-based spread and use oat or almond milk in the glaze. Vegetarian marshmallow substitutes made from agar or pectin will keep these meat-free; however, texture may be slightly different and require more pressing. To make the rings gluten-free choose a certified gluten-free puffed rice and check that marshmallows do not contain cross-contaminants. For deeper maple flavor, replace 1 teaspoon of milk in the glaze with real maple syrup and reduce powdered sugar slightly to maintain consistency.

Serving Suggestions

Serve these rings warm or at room temperature alongside spiced coffee, chai, or a milky latte. Garnish with a light dusting of extra cinnamon or finely chopped toasted pecans for crunch. They make a charming addition to a fall dessert board paired with caramel apples, pumpkin muffins, or soft ginger cookies. For a brunch, present them on a tiered stand with small labels—kids love grabbing the rings and adults appreciate the nostalgic profile with a seasonal twist.

Cultural Background

These seasonal rings are a playful American adaptation of classic cereal treats, reimagined for autumn with pumpkin purée and warm spices. Crisped rice cereal became popular in the United States in the early 20th century, and marshmallow-cereal confections have long been a staple of American home baking for their simplicity and kid-friendly appeal. Adding pumpkin and spice ties the treat to fall harvest celebrations and Thanksgiving traditions, offering a casual, portable dessert that channels classic holiday flavors without the formality of pie.

Seasonal Adaptations

In late summer, swap pumpkin for a thin pear purée with a pinch of cardamom for a lighter variation. During winter holidays, mix in a teaspoon of cocoa powder and sprinkle with crushed peppermint for a festive twist. For spring, fold in freeze-dried strawberry powder and use a lemon glaze. Small changes—like switching the spice blend or adding toasted nuts—can tailor the rings to different celebrations while keeping the basic technique intact.

Meal Prep Tips

Make the base rings ahead and store unglazed in an airtight container for up to three days; glaze just before serving to keep them fresh and glossy. For busy mornings, portion single rings into small resealable bags for grab-and-go snacks. If you plan to freeze, do so without glaze and flash-freeze on a tray first to prevent sticking. Thaw in the fridge and finish with glaze; the texture will stay closer to fresh this way than freezing after glazing.

These pumpkin Rice Krispies rings are proof that quick, thoughtful cooking can feel celebratory. They pair nostalgia with seasonal flavor, and once you master the press-and-glaze rhythm you'll find yourself adapting them all year round. Make a batch, invite someone over, and watch the kitchen fill with that warm, familiar aroma that always brings people together.

Pro Tips

  • Grease your hands lightly with butter or nonstick spray before pressing to prevent sticking and to achieve smooth edges.

  • Press the mixture firmly and evenly into the donut cavities so rings hold shape; inconsistent pressure leads to crumbly edges.

  • If the marshmallow mixture begins to set while working, briefly rewarm the pot on very low heat to loosen it—avoid boiling.

  • For a thinner glaze add milk 1 teaspoon at a time until desired consistency is reached; a thicker glaze gives a glossy topping whereas thinner will drip.

  • Toast chopped nuts or seeds before adding as a topping to enhance aroma and provide contrast to the soft texture.

This nourishing easy pumpkin rice krispies donuts for the sweetest fall treat recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long do these rings stay fresh?

Store in an airtight container at room temperature for up to 3 days; refrigerate up to 5–7 days but allow to come to room temperature before serving.

Can I make a gluten-free version?

Yes—use a certified gluten-free puffed rice cereal and verify marshmallows are gluten-free to adapt the recipe.

Are these vegetarian or vegan?

Standard marshmallows contain gelatin. Use plant-based marshmallows to make a vegetarian or vegan-friendly version and swap butter/milk for plant-based alternatives.

Tags

Baked Goodsfall-recipespumpkindessertssnackskid-friendlyrecipes
No ratings yet

Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat

This Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 8 steaks
Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat
Prep:15 minutes
Cook:10 minutes
Rest Time:10 mins
Total:25 minutes

Ingredients

Donuts

Maple-Cinnamon Glaze

Instructions

1

Melt butter and marshmallows

Over medium-low heat in a large pot, melt 3 tablespoons butter. Add the 10-ounce bag of mini marshmallows and stir constantly until glossy and mostly melted, about 3–5 minutes. Keep heat low to prevent browning.

2

Stir in pumpkin and spices

Lower the heat and stir in 1/2 cup canned pumpkin purée, 1 teaspoon pumpkin pie spice, and a pinch of salt. Mix until smooth and well combined. Add a few drops of orange dye if desired and blend evenly.

3

Fold in cereal

Remove the pot from heat and fold in 6 cups Rice Krispies cereal with a spatula, coating evenly. Work quickly to incorporate the cereal before the marshmallow sets.

4

Press into donut pan

Grease a donut pan and your hands. Press the mixture firmly into each cavity, compacting evenly for defined edges. Let sit at room temperature until cool and set, about 20–30 minutes.

5

Prepare glaze

Whisk together 3/4 cup powdered sugar, 2 tablespoons milk, 1/2 teaspoon cinnamon, and a pinch of salt in a medium bowl. Thin with additional milk 1 teaspoon at a time if needed.

6

Glaze and set

Dip the tops of each ring into the glaze or spoon it over. Place on a wire rack and allow glaze to set for at least 15 minutes before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 220kcal | Carbohydrates: 35g | Protein:
2g | Fat: 7g | Saturated Fat: 2g |
Polyunsaturated Fat: 1g | Monounsaturated Fat:
3g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@epicula on social media!

Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat

Categories:

Easy Pumpkin Rice Krispies Donuts for the Sweetest Fall Treat

Did You Make This?

Leave a comment & rating below or tag @epicula on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Olivia!

Chef and recipe creator specializing in delicious Baked Goods cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.